Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Melanocortin-3 R/MC3R Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Melanocortin-3 R/MC3R |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Melanocortin-3 R/MC3R Polyclonal specifically detects Melanocortin-3 R/MC3R in Human, Mouse samples. It is validated for Western Blot.Specifications
| Melanocortin-3 R/MC3R | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS buffer, 2% sucrose | |
| 4159 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| BMIQ9, MC3, MC3-R, melanocortin 3 receptor, melanocortin receptor 3, OB20, Obesity quantitative trait locus, OQTL | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human Melanocortin-3 R/MC3R (NP_063941.3). Peptide sequence PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title