Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MERIT40/HSPC142 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258126

Catalog No. NBP258126


Add to cart

Description

Description

MERIT40/HSPC142 Polyclonal antibody specifically detects MERIT40/HSPC142 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

MERIT40/HSPC142
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
BRISC and BRCA1 A complex member 1, C10orf62, C19orf62, chromosome 19 open reading frame 62, FLJ20571, HSPC142, mediator of Rap80 interactions and targeting 40 kDa, Mediator of RAP80 interactions and targeting subunit of 40 kDa, MERIT40BRCA1-A complex subunit MERIT40, NBA1BRISC and BRCA1 A complex member, new component of the BRCA1 A complex, New component of the BRCA1-A complex, new component of the BRCAA1 A complex
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
BABAM1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
Affinity purified
RUO
Primary
29086
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only