Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Methionine Aminopeptidase 1/METAP1 Antibody, Novus Biologicals™

Methionine Aminopeptidase 1/METAP1 Antibody, Novus Biologicals™
SDP

Catalog No. p-7106332 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153088 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP153088 Supplier Novus Biologicals Supplier No. NBP153088
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Methionine Aminopeptidase 1/METAP1 Polyclonal specifically detects Methionine Aminopeptidase 1/METAP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Methionine Aminopeptidase 1/METAP1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias DKFZp781C0419, EC 3.4.11.18, KIAA0094MAP 1, MAP1A, MetAP 1, MetAP1A, methionine aminopeptidase 1, methionyl aminopeptidase 1, Peptidase M 1
Gene Symbols METAP1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to METAP1(methionyl aminopeptidase 1) The peptide sequence was selected from the N terminal of METAP1. Peptide sequence GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism, Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 23173
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.