Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Methionine Aminopeptidase 1/METAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Methionine Aminopeptidase 1/METAP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Methionine Aminopeptidase 1/METAP1 Polyclonal specifically detects Methionine Aminopeptidase 1/METAP1 in Human samples. It is validated for Western Blot.Specifications
Methionine Aminopeptidase 1/METAP1 | |
Polyclonal | |
Rabbit | |
DKFZp781C0419, EC 3.4.11.18, KIAA0094MAP 1, MAP1A, MetAP 1, MetAP1A, methionine aminopeptidase 1, methionyl aminopeptidase 1, Peptidase M 1 | |
METAP1 | |
IgG | |
30 kDa |
Western Blot | |
Unconjugated | |
RUO | |
23173 | |
Synthetic peptides corresponding to METAP1(methionyl aminopeptidase 1) The peptide sequence was selected from the N terminal of METAP1. Peptide sequence GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title