Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Methionine Sulfoxide Reductase A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Methionine Sulfoxide Reductase A |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
Methionine Sulfoxide Reductase A Polyclonal specifically detects Methionine Sulfoxide Reductase A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Methionine Sulfoxide Reductase A | |
Unconjugated | |
RUO | |
cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase | |
MSRA | |
IgG |
Polyclonal | |
Rabbit | |
Q9UJ68 | |
4482 | |
Synthetic peptides corresponding to MSRA (methionine sulfoxide reductase A) The peptide sequence was selected from the middle region of MSRA)(50ug). Peptide sequence YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title