Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Methyltransferase like 5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Methyltransferase like 5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Methyltransferase like 5 Polyclonal specifically detects Methyltransferase like 5 in Human samples. It is validated for Western Blot.Specifications
Methyltransferase like 5 | |
Polyclonal | |
Rabbit | |
Q9NRN9 | |
29081 | |
Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5. Peptide sequence KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 2.1.1.-, FLJ10459, HSPC133, methyltransferase like 5, methyltransferase-like protein 5 | |
METTL5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title