Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
METTL11B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | METTL11B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
METTL11B Polyclonal specifically detects METTL11B in Human samples. It is validated for Western Blot.Specifications
METTL11B | |
Polyclonal | |
Rabbit | |
C1orf184, methyltransferase like 11B, methyltransferase-like protein 11B, NTM1B, X-Pro-Lys N-terminal protein methyltransferase 1B | |
METTL11B | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
149281 | |
Synthetic peptides corresponding to C1ORF184 The peptide sequence was selected from the C terminal of C1ORF184. Peptide sequence NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title