Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
METTL21C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | METTL21C |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
METTL21C Polyclonal specifically detects METTL21C in Human samples. It is validated for Western Blot.Specifications
| METTL21C | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C13orf39, chromosome 13 open reading frame 39, EC 2.1.1.-, hypothetical protein LOC196541, LOC196541, methyltransferase like 21C | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human METTL21C (NP_001010977). Peptide sequence AQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQK | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 196541 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title