Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89335087

MFN2, Mouse anti-Human, Clone: 6A8, Abnova™

Catalog No. 89335087 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-335-087 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-335-087 Supplier Abnova Corporation Supplier No. H00009927M01J
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Sequence: FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Specifications

Antigen MFN2
Applications ELISA, Immunohistochemistry (Paraffin), Western Blot
Classification Monoclonal
Clone 6A8
Conjugate Unconjugated
Formulation PBS with no preservative; pH 7.4
Gene mitofusin 2
Gene Accession No. NM_014874
Gene Alias CMT2A/CMT2A2/CPRP1/HSG/KIAA0214/MARF
Gene Symbols MFN2
Host Species Mouse
Immunogen MFN2 (NP_055689, 661 a.a. ∼ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9927
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.