Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFRP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MFRP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MFRP Polyclonal specifically detects MFRP in Human samples. It is validated for Western Blot.Specifications
MFRP | |
Polyclonal | |
Rabbit | |
Growth and Development, Neuronal Cell Markers, Vision | |
MCOP5, membrane frizzled-related protein, Membrane-type frizzled-related protein, MGC32938, NNO2, RD6 | |
MFRP | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9BY79 | |
83552 | |
Synthetic peptides corresponding to MFRP(membrane frizzled-related protein) The peptide sequence was selected from the middle region of MFRP. Peptide sequence HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title