Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MFSD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MFSD8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MFSD8 Polyclonal specifically detects MFSD8 in Human samples. It is validated for Western Blot.Specifications
MFSD8 | |
Polyclonal | |
Rabbit | |
NP_689991 | |
256471 | |
Synthetic peptide directed towards the middle region of human MFSD8The immunogen for this antibody is MFSD8. Peptide sequence FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ceroid-lipofuscinosis, neuronal 7, late infantile, variant, CLN7, major facilitator superfamily domain containing 8, major facilitator superfamily domain-containing protein 8, MGC33302neuronal 7, late infantile | |
MFSD8 | |
IgG | |
57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title