Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGC16471 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MGC16471 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MGC16471 Polyclonal specifically detects MGC16471 in Human samples. It is validated for Western Blot.Specifications
MGC16471 | |
Polyclonal | |
Rabbit | |
NP_620162 | |
132001 | |
Synthetic peptide directed towards the middle region of human C3orf31. Peptide sequence LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 3 open reading frame 31, DKFZp434E0519, MGC16471, mitochondrial | |
TAMM41 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title