MGC4172 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23068625UL

Catalog No. NB437465

Description

MGC4172 Polyclonal specifically detects MGC4172 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MGC4172
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q6UWP2
• Gene Symbols: DHRS11
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAIRSQHSGVDICINNAGL
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 79154
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ARPG836, dehydrogenase/reductase (SDR family) member 11, dehydrogenase/reductase SDR family member 11, FLJ39232, MGC4172, SDR24C1, short chain dehydrogenase/reductase family 24C, member 1, short-chain dehydrogenase/reductase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only