Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MGMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MGMT |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MGMT Polyclonal specifically detects MGMT in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
MGMT | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Chromatin Research, Direct Reversal of DNA Damage, DNA Repair, Tumor Suppressors | |
6-O-methylguanine-DNA methyltransferase, EC 2.1.1.63, methylated-DNA--protein-cysteine methyltransferase, methylguanine-DNA methyltransferase, O-6-methylguanine-DNA methyltransferase, O6-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase | |
MGMT | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
4255 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title