Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MHC Class I Rabbit anti-Human, Clone: 3I1C1, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP316696100UL
This item is not returnable.
View return policy
Description
MHC Class I Monoclonal antibody specifically detects MHC Class I in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| MHC Class I | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunofluorescence | |
| 3I1C1 | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| DKFZp686P19218, EA1.2, EA2.1, HLA class I histocompatibility antigen, alpha chain E, HLA class I histocompatibility antigen, E alpha chain, HLA-6.2, HLAE, lymphocyte antigen, major histocompatibility complex, class I, E, MHC, MHC class I antigen E, MHC HLA-E alpha-1, MHC HLA-E alpha-2.1, QA1 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MHC Class I (P04439). KETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL | |
| 100 μg | |
| Adaptive Immunity, Asthma, Cell Biology, Core ESC Like Genes, Diabetes Research, DNA Repair, DNA replication Transcription Translation and Splicing, Immunology, Stem Cell Markers | |
| 3133 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction