MHC Class I Rabbit anti-Human, Clone: 3I1C1, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31669620UL

Catalog No. NB168484

Description

MHC Class I Monoclonal antibody specifically detects MHC Class I in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: MHC Class I
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 3I1C1
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: DKFZp686P19218, EA1.2, EA2.1, HLA class I histocompatibility antigen, alpha chain E, HLA class I histocompatibility antigen, E alpha chain, HLA-6.2, HLAE, lymphocyte antigen, major histocompatibility complex, class I, E, MHC, MHC class I antigen E, MHC HLA-E alpha-1, MHC HLA-E alpha-2.1, QA1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MHC Class I (P04439). KETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
• Quantity: 20 μg
• Research Discipline: Adaptive Immunity, Asthma, Cell Biology, Core ESC Like Genes, Diabetes Research, DNA Repair, DNA replication Transcription Translation and Splicing, Immunology, Stem Cell Markers
• Gene ID (Entrez): 3133
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG