Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$646.00
Specifications
Antigen | MIA3 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MIA3 Polyclonal specifically detects MIA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MIA3 | |
Polyclonal | |
Rabbit | |
Human | |
Q5JRA6 | |
375056 | |
This antibody was developed against a recombinant protein corresponding to amino acids: DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ARNT, C219 Reactive Peptide, C219-Reactive Peptide, D320, KIAA0268, Melanoma Inhibitory Activity Family, Member 3, Melanoma Inhibitory Activity Protein 3, TANGO, TANGO1, Transport And Golgi Organization, Transport And Golgi Organization Protein 1, UNQ6077 | |
MIA3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title