MIA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436615	Novus Biologicals NBP23416025UL	25 μL
NBP234160	Novus Biologicals NBP234160	0.1 mL

Description

MIA3 Polyclonal specifically detects MIA3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MIA3
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ARNT, C219 Reactive Peptide, C219-Reactive Peptide, D320, KIAA0268, Melanoma Inhibitory Activity Family, Member 3, Melanoma Inhibitory Activity Protein 3, TANGO, TANGO1, Transport And Golgi Organization, Transport And Golgi Organization Protein 1, UNQ6077
• Gene Symbols: MIA3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q5JRA6
• Gene ID (Entrez): 375056
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only