Invitrogen™ MICA Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579671

Catalog No. PIPA579671

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Raji whole cell, human SGC-7901 whole cell, human SW620 whole cell, huamn Jurkat whole cell.

Major histocompatibility complex (MHC) class I proteins are ubiquitously expressed and mediate the recognition of intracellular antigens by cytotoxic T cells. A related family, termed the MHC class I chain-related (MIC) proteins are recognized by NKG2D, a receptor on NK and T cells, and promote anti-tumor activity. MICA, a member of the MIC family, is widely expressed on many tumors, and it is the MICA/NKG2D interaction that is thought to stimulate the anti-tumor reactivity by T lymphocytes. Both MICA and MICB mRNA are widely expressed in normal tissues, with MICA being present in virtually every tissue except the nervous system, suggesting that MIC protein expression may only be one component of the anti-tumor activity of the immune system.

Specifications

• Antigen: MICA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MICA
• Gene Alias: DAMA-345G11.2; HLA class I antigen; MHC class I chain-related protein A; MHC class I polypeptide-related sequence A; MHC class I related sequence A; MICA; MIC-A; PERB11.1; stress inducible class I homolog; truncated MHC class I polypeptide-related sequence A
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 100507436
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4 mg trehalose and 0.01 mg sodium azide
• Gene Accession No.: Q29983
• Gene Symbols: MICA
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov