Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MIER1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181730

 View more versions of this product

Catalog No. NBP181730


Only null left
Add to Cart

Description

Description

MIER1 Polyclonal specifically detects MIER1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

MIER1
Polyclonal
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
DKFZp781G0451, Early response 1, ER1, hMI-ER1, KIAA1610MI-ER1, mesoderm induction early response 1 (MI-ER1), mesoderm induction early response 1 homolog (Xenopus laevis), mesoderm induction early response protein 1, MGC131940, MGC150640, MGC150641, Mi-er1
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
MIER1
This antibody was developed against Recombinant Protein corresponding to amino acids:MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI
0.1 mL
Cell Cycle and Replication
57708
Human
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only