Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIER3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MIER3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MIER3 Polyclonal specifically detects MIER3 in Human samples. It is validated for Western Blot.Specifications
MIER3 | |
Polyclonal | |
Rabbit | |
NP_689835 | |
166968 | |
Synthetic peptide directed towards the middle region of human MIER3. Peptide sequence MNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954, mesoderm induction early response 1, family member 3, mesoderm induction early response protein 3, mi-er3 | |
MIER3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title