Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIG2/Kindlin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | MIG2/Kindlin-2 |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
Description
MIG2/Kindlin-2 Polyclonal specifically detects MIG2/Kindlin-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| MIG2/Kindlin-2 | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96AC1 | |
| 10979 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 78 kDa |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| fermitin family homolog 2, fermitin family homolog 2 (Drosophila), fermitin family member 2, KIND2DKFZp686G11125, kindlin 2, Kindlin-2, mig-2, MIG2FLJ34213, mitogen inducible gene 2 protein, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, pleckstrin homology domain containing, family C (with FERM domain) member 1, pleckstrin homology domain containing, family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1FLJ44462, UNC112, UNC112B | |
| FERMT2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title