Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIG2/Kindlin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317740100UL
This item is not returnable.
View return policy
Description
MIG2/Kindlin-2 Polyclonal antibody specifically detects MIG2/Kindlin-2 in Human samples. It is validated for ImmunofluorescenceSpecifications
| MIG2/Kindlin-2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| fermitin family homolog 2, fermitin family homolog 2 (Drosophila), fermitin family member 2, KIND2DKFZp686G11125, kindlin 2, Kindlin-2, mig-2, MIG2FLJ34213, mitogen inducible gene 2 protein, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, pleckstrin homology domain containing, family C (with FERM domain) member 1, pleckstrin homology domain containing, family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1FLJ44462, UNC112, UNC112B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10979 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction