Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mindin/Spondin-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159177
Description
Mindin/Spondin-2 Polyclonal specifically detects Mindin/Spondin-2 in Human samples. It is validated for Western Blot.Specifications
| Mindin/Spondin-2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Differentially expressed in cancerous and non-cancerous lung cells 1, DIL-1, DIL1FLJ34460, DKFZp686G21139, FLJ16313, FLJ22401, MINDIN, M-SPONDIN, spondin 2, extracellular matrix protein, spondin-2 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10417 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9BUD6 | |
| SPON2 | |
| Synthetic peptides corresponding to SPON2(spondin 2, extracellular matrix protein) The peptide sequence was selected from the middle region of SPON2. Peptide sequence GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction