Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MiRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | MiRP1 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MiRP1 Polyclonal specifically detects MiRP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MiRP1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ATFB4, cardiac voltage-gated potassium channel accessory subunit 2, human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1, LQT5, LQT6, MGC138292, MinK-related peptide 1, minK-related peptide-1, MIRP1, Potassium channel subunit beta MiRP1, potassium channel subunit, MiRP1, potassium voltage-gated channel subfamily E member 2, potassium voltage-gated channel, Isk-related family, member 2, voltage-gated K+ channel subunit MIRP1 | |
KCNE2 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
Q9Y6J6 | |
9992 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title