Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIS RII/AMHR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | MIS RII/AMHR2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB124815
|
Novus Biologicals
NBP309957100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
MIS RII/AMHR2 Polyclonal specifically detects MIS RII/AMHR2 in Human samples. It is validated for Western Blot.Specifications
| MIS RII/AMHR2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS buffer, 2% sucrose | |
| 269 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AMH type II receptor, AMHREC 2.7.11.30, MISR2, MISRIIMIS type II receptor, MRII, Muellerian hormone type II receptor, Muellerian hormone type-2 receptor, Mullerian hormone receptor, type II, Mullerian inhibiting substance type II receptor | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human MIS RII/AMHR2. Peptide sequence VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title