Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIS RII/AMHR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | MIS RII/AMHR2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
MIS RII/AMHR2 Polyclonal specifically detects MIS RII/AMHR2 in Human samples. It is validated for Western Blot.Specifications
| MIS RII/AMHR2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS buffer, 2% sucrose | |
| 269 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AMH type II receptor, AMHREC 2.7.11.30, MISR2, MISRIIMIS type II receptor, MRII, Muellerian hormone type II receptor, Muellerian hormone type-2 receptor, Mullerian hormone receptor, type II, Mullerian inhibiting substance type II receptor | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human MIS RII/AMHR2. Peptide sequence VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title