Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIS18A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | MIS18A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170753
|
Novus Biologicals
NBP170753 |
100 μL |
Each for $436.00
|
|
NBP17075320
|
Novus Biologicals
NBP17075320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
MIS18A Polyclonal specifically detects MIS18A in Human samples. It is validated for Western Blot.Specifications
| MIS18A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 54069 | |
| Synthetic peptides corresponding to Mis18a Antibody (against the N terminal of Mis18a). Peptide sequence MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B28, C21orf45, C21orf46, FAPP1-associated protein 1, FASP1, hMis18alpha, MIS18 kinetochore protein homolog A (S. pombe), MIS18alpha, protein Mis18-alpha | |
| MIS18A | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title