Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIS18A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MIS18A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MIS18A Polyclonal specifically detects MIS18A in Human samples. It is validated for Western Blot.Specifications
MIS18A | |
Polyclonal | |
Rabbit | |
B28, C21orf45, C21orf46, FAPP1-associated protein 1, FASP1, hMis18alpha, MIS18 kinetochore protein homolog A (S. pombe), MIS18alpha, protein Mis18-alpha | |
MIS18A | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
54069 | |
Synthetic peptides corresponding to Mis18a Antibody (against the N terminal of Mis18a). Peptide sequence MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWAS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title