Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MISP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
MISP1 Polyclonal specifically detects MISP1 in Human samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
chromosome 19 open reading frame 21, DKFZp686H18209, hypothetical protein LOC126353 | |
Synthetic peptides corresponding to C19ORF21 The peptide sequence was selected from the C terminal of C19ORF21. Peptide sequence RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS. | |
Primary |
Polyclonal | |
Rabbit | |
Q8IVT2 | |
126353 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title