mitochondrial ribosomal protein L4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213617

Catalog No. NBP213617

Description

mitochondrial ribosomal protein L4 Polyclonal specifically detects mitochondrial ribosomal protein L4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: mitochondrial ribosomal protein L4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CGI-28, L4mt, MGC16367, MGC2681, mitochondrial ribosomal protein L4,39S ribosomal protein L4, mitochondrial, MRP-L4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MRPL4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MLQFVRAGARAWLRPTGSQGLSSLAEEAARATENPEQVASEGLPEPVLRKVELPVPTHRRPVQAWVESLRGFEQERVGLADLHPDVFATAPRLDILHQVA
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51073
• Target Species: Human
• Isotype: IgG

For Research Use Only