Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MLF1 Interacting Protein Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | MLF1 Interacting Protein |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
MLF1 Interacting Protein Polyclonal specifically detects MLF1 Interacting Protein in Human samples. It is validated for Western Blot.Specifications
| MLF1 Interacting Protein | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Phospho Specific | |
| PBS buffer, 2% sucrose | |
| 79682 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CENP-50, CENP-U, CENPU50, CENPUMLF1-interacting protein, centromere protein of 50 kDa, centromere protein U, FLJ23468, ICEN24, Interphase centromere complex protein 24, KLIP1CENP50, KSHV latent nuclear antigen interacting protein 1, KSHV latent nuclear antigen-interacting protein 1, MLF1 interacting protein, PBIP1, Polo-box-interacting protein 1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human MLF1 Interacting Protein (NP_078905.2). Peptide sequence ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHL | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title