Learn More
MLF1 Interacting Protein Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | MLF1 Interacting Protein |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CENP-50, CENP-U, CENPU50, CENPUMLF1-interacting protein, centromere protein of 50 kDa, centromere protein U, FLJ23468, ICEN24, Interphase centromere complex protein 24, KLIP1CENP50, KSHV latent nuclear antigen interacting protein 1, KSHV latent nuclear antigen-interacting protein 1, MLF1 interacting protein, PBIP1, Polo-box-interacting protein 1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human MLF1 Interacting Protein (NP_078905.2). Peptide sequence ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHL |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.