Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MLKL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications
Supplier: Novus Biologicals NBP156729
Description
MLKL Polyclonal specifically detects MLKL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
MLKL | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ34389, mixed lineage kinase domain-like, mixed lineage kinase domain-like protein | |
Rabbit | |
54 kDa | |
100 μL | |
Protein Kinase | |
197259 | |
Human, Rat, Bovine, Equine | |
IgG |
Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin | |
Q8NB16 | |
MLKL | |
Synthetic peptides corresponding to MLKL(mixed lineage kinase domain-like) The peptide sequence was selected from the N terminal of MLKL (NP_689862). Peptide sequence DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction