Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MLL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
Antigen | MLL3 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MLL3 Polyclonal specifically detects MLL3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MLL3 | |
Polyclonal | |
Rabbit | |
Human | |
58508 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
ALR-like protein, DKFZp686C08112, EC 2.1.1.43, FLJ12625, HALRMGC119851, histone-lysine N-methyltransferase MLL3, histone-lysine N-methyltransferase, H3 lysine-4 specific, Homologous to ALR protein, KIAA1506FLJ38309, KMT2C, KMT2CMGC119852, Lysine N-methyltransferase 2C, MGC119853, myeloid/lymphoid or mixed-lineage leukemia 3, Myeloid/lymphoid or mixed-lineage leukemia protein 3 | |
KMT2C | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title