Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-15/MT2-MMP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | MMP-15/MT2-MMP |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
MMP-15/MT2-MMP Polyclonal specifically detects MMP-15/MT2-MMP in Human samples. It is validated for Western Blot.Specifications
| MMP-15/MT2-MMP | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Extracellular Matrix | |
| PBS buffer, 2% sucrose | |
| 4324 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), Membrane-type matrix metalloproteinase 2, Membrane-type-2 matrix metalloproteinase, MMP-15, MT2-MMPMT2MMP, MTMMP2MT-MMP 2, SMCP-2matrix metalloproteinase-15 | |
| The immunogen is a synthetic peptide directed towards the middle region of human MMP-15/MT2-MMP (NP_002419.1). Peptide sequence DDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGK | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title