Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25784525UL
Description
MMP-19 Polyclonal specifically detects MMP-19 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| MMP-19 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| EC 3.4.24.-, matrix metallopeptidase 19, matrix metalloproteinase 18, matrix metalloproteinase 19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18, matrix metalloproteinase-19, MMP-18, MMP18MMP-19, RASI, RASI-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| MMP19 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNL | |
| 25 μL | |
| Angiogenesis, Cancer, Extracellular Matrix | |
| 4327 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction