Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579678

Invitrogen™ MMP11 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579678
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579678 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579678 Supplier Invitrogen™ Supplier No. PA579678
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, MM231 whole cell. IHC: mouse spleen tissue, rat spleen tissue, human appendicitis tissue.

Stromelysin, a member of the matrix metalloproteinase family, demonstrates wide substrate specificity with the ability to degrade proteoglycan, fibronectin, laminin, casein, and the nonhelical region of collagen. The stromelysin-3 (MMP-11) gene was originally identified on the basis that it is expressed specifically in stromal cells surrounding invasive breast carcinomas. MMP-11 is localized by in situ hybridization to the long arm of chromosome 22. The MMP-11 expression is found more specifically in malignant tumors than in benign ones.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MMP11
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Mmp11
Gene Accession No. P24347, Q02853, Q499S5
Gene Alias matrix metallo protease; matrix metallopeptidase 11; matrix metallopeptidase 11 (stromelysin 3); Matrix metalloproteinase 11 (stromelysin 3); matrix metalloproteinase-11; MMP; MMP11; MMP-11; MMPs; SL-3; ST3; Stmy3; stromelysin III; stromelysin-3
Gene Symbols Mmp11
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17385, 25481, 4320
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.