Invitrogen™ MMP12 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579679

Catalog No. PIPA579679

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HEPA whole cell.

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. The gene is part of a cluster of MMP genes which localize to chromosome 11q22. 3.

Specifications

• Antigen: MMP12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Mmp12
• Gene Alias: 3.4.24.65; AV378681; HME; Macrophage elastase; macrophage metalloelastase; macrophage-metalloelastase; matrix metallo protease; matrix metallopeptidase 12; matrix metallopeptidase 12 (macrophage elastase); matrix metalloproteinase 12; matrix metalloproteinase 12 (macrophage elastase); matrix metalloproteinase-12; ME; MGC138506; MME; Mmel; MMP; Mmp12; MMP-12; MMPs
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17381
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: ELISA, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P34960
• Gene Symbols: Mmp12
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov