Invitrogen™ MMP3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579683

Catalog No. PIPA579683

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Human Placenta Tissue, U20S whole cell, HELA whole cell, PANC whole cell, COLO320 whole cell.

MMP3 (stromelysin-1) belongs to the peptidase M10A subfamily. It is secreted in its pro-protein form, and is activated by extracellular proteinase cleavage. MMP3 is capable of binding to zinc and calcium ions, and has metallo-endopeptidase activity. The active enzyme degrades collagen, gelatin, fibronectin, and laminin. It is involved in normal cellular processes such as wound repair and tissue remodeling. Mutations in the gene can result in coronary heart disease 6.

Specifications

• Antigen: MMP3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MMP3
• Gene Alias: CHDS6; EC 3.4.24.17; EMS-2; matrix metallo protease; matrix metallopeptidase 3; matrix metallopeptidase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3; matrix metalloproteinase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3 precursor; matrix metalloproteinase-3; metalloproteinase 3 receptor; MMP; MMP10; MMP3; MMP-3; MMP-3 protein; MMPs; progelatinase; proteoglycanase; SL-1; SLN1; SLN-1; STMY; STMY1; Str1; STR-1; stromelysin; stromelysin 1; Stromelysin1; stromelysin-1; Transin1; Transin-1
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 4314
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P08254
• Gene Symbols: MMP3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3 (410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG