Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ MMP8 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579687
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Testis Tissue, NIH3T3 whole cell, HEPA whole cell, NRK whole cell. IHC: Mouse Spleen tissue, Rat Spleen tissue.
The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.
Specifications
MMP8 | |
Polyclonal | |
Unconjugated | |
MMP8 | |
BB138268; CLG1; Collagenase; Collagenase 2; collagenase-2; HNC; matrix metallo protease; matrix metallopeptidase 8; matrix metallopeptidase 8 (neutrophil collagenase); matrix metalloproteinase 8; matrix metalloproteinase 8 (neutrophil collagenase); Matrix metalloproteinase8; matrix metalloproteinase-8; MMP; MMP 8; Mmp8; MMP-8; MMPs; Neutrophil collagenase; neutrophil collagenease; PMN leukocyte collagenase; PMNL CL; PMNL collagenase; PMNLCL; PMNL-CL | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
17394, 63849 | |
-20°C | |
Lyophilized |
ELISA, Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
O70138, O88766 | |
MMP8 | |
A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD). | |
100 μg | |
Primary | |
Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction