Invitrogen™ MMP8 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579687

Catalog No. PIPA579687

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Testis Tissue, NIH3T3 whole cell, HEPA whole cell, NRK whole cell. IHC: Mouse Spleen tissue, Rat Spleen tissue.

The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.

Specifications

• Antigen: MMP8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: MMP8
• Gene Alias: BB138268; CLG1; Collagenase; Collagenase 2; collagenase-2; HNC; matrix metallo protease; matrix metallopeptidase 8; matrix metallopeptidase 8 (neutrophil collagenase); matrix metalloproteinase 8; matrix metalloproteinase 8 (neutrophil collagenase); Matrix metalloproteinase8; matrix metalloproteinase-8; MMP; MMP 8; Mmp8; MMP-8; MMPs; Neutrophil collagenase; neutrophil collagenease; PMN leukocyte collagenase; PMNL CL; PMNL collagenase; PMNLCL; PMNL-CL
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 17394, 63849
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O70138, O88766
• Gene Symbols: MMP8
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Product Type: Antibody
• Isotype: IgG