Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595308

Invitrogen™ MMP8 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595308
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595308 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595308 Supplier Invitrogen™ Supplier No. PA595308
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: K562 whole cell, JURKAT whole cell. IHC: Human Appendicitis tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MMP8
Applications ELISA, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene MMP8
Gene Accession No. P22894
Gene Alias BB138268; CLG1; Collagenase; Collagenase 2; collagenase-2; HNC; matrix metallo protease; matrix metallopeptidase 8; matrix metallopeptidase 8 (neutrophil collagenase); matrix metalloproteinase 8; matrix metalloproteinase 8 (neutrophil collagenase); Matrix metalloproteinase8; matrix metalloproteinase-8; MMP; MMP 8; Mmp8; MMP-8; MMPs; Neutrophil collagenase; neutrophil collagenease; PMN leukocyte collagenase; PMNL CL; PMNL collagenase; PMNLCL; PMNL-CL
Gene Symbols MMP8
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MMP-8 (119-153aa NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4317
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.