Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMR/CD206/Mannose Receptor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications
$382.00
Specifications
Antigen | MMR/CD206/Mannose Receptor |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Flow Cytometry Validated for Flow from a verified customer review., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 28620274)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
MMR/CD206/Mannose Receptor Polyclonal specifically detects MMR/CD206/Mannose Receptor in Human, Mouse, Porcine, Primate samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
MMR/CD206/Mannose Receptor | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
4360 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.04-0.4 ug/ml, Flow Cytometry Validated for Flow from a verified customer review., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 28620274)., Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human, Mouse, Pig | |
CD206, CLEC13Dmacrophage mannose receptor 1, C-type lectin domain family 13 member D, mannose receptor, C type 1, MMRCD206 antigen | |
MRC1 | |
IgG | |
Affinity Purified | |
Specificity of human MMR/CD206/Mannose Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title