Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MMR/CD206/Mannose Receptor Antibody, Novus Biologicals™
SDP

Catalog No. p-200047968 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430521 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB430521 Supplier Novus Biologicals Supplier No. NBP19002025UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 8 publications

MMR/CD206/Mannose Receptor Polyclonal specifically detects MMR/CD206/Mannose Receptor in Human, Mouse, Porcine, Primate samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MMR/CD206/Mannose Receptor
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Flow Cytometry Validated for Flow from a verified customer review., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 28620274)., Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD206, CLEC13Dmacrophage mannose receptor 1, C-type lectin domain family 13 member D, mannose receptor, C type 1, MMRCD206 antigen
Gene Symbols MRC1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4360
Test Specificity Specificity of human MMR/CD206/Mannose Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Pig
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.