Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MNAB Antibody, Novus Biologicals™

MNAB Antibody, Novus Biologicals™
SDP

Catalog No. NB438661 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB438661 25ul
NBP213212 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB438661 Supplier Novus Biologicals Supplier No. NBP21321225UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MNAB Polyclonal specifically detects MNAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MNAB
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
Gene Symbols RC3H2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 54542
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.