Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MNAB Antibody, Novus Biologicals™

MNAB Antibody, Novus Biologicals™
SDP

Catalog No. p-200059285 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392899 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392899 Supplier Novus Biologicals Supplier No. NBP26878525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MNAB Polyclonal antibody specifically detects MNAB in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen MNAB
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 54542
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.