Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOBKL2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MOBKL2A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MOBKL2A Polyclonal specifically detects MOBKL2A in Human samples. It is validated for Western Blot.Specifications
MOBKL2A | |
Polyclonal | |
Rabbit | |
Q96BX8 | |
126308 | |
Synthetic peptides corresponding to MOBKL2A (MOB1, Mps One Binder kinase activator-like 2A (yeast)) The peptide sequence was selected from the middle region of MOBKL2A. Peptide sequence EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MOB LAK, Mob1 homolog 2A, MOB1, Mps One Binder kinase activator-like 2A (yeast), MOB3A, moblak, MOB-LAKmps one binder kinase activator-like 2A, Protein Mob3A | |
MOB3A | |
IgG | |
25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title