Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOCS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21424425UL
Description
MOCS3 Polyclonal specifically detects MOCS3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MOCS3 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
adenylyltransferase and sulfurtransferase MOCS3, dJ914P20.3, molybdenum cofactor synthesis 3, Molybdenum cofactor synthesis protein 3, Molybdopterin synthase sulfurylase, MPT synthase sulfurylase, UBA4, ubiquitin-activating enzyme E1 homolog, UBA4MGC9252, ubiquitin-like modifier activating enzyme 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
27304 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MOCS3 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: FQDEILRSSRQLVLPELGVHRHVLVVGCGGLRCPLAQYLAAASVGRLGLVDYDVVEMSNLAYQVLHGEALAAQAKAASAAASLRGLNLAVE | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction