Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOSPD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | MOSPD3 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160035
|
Novus Biologicals
NBP160035 |
100 μL |
Each of 1 for $436.00
|
|
Description
MOSPD3 Polyclonal specifically detects MOSPD3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MOSPD3 | |
Polyclonal | |
Purified | |
RUO | |
CDS3, motile sperm domain containing 3, motile sperm domain-containing protein 3, NET30 | |
MOSPD3 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
64598 | |
Synthetic peptides corresponding to MOSPD3(motile sperm domain containing 3) The peptide sequence was selected from the C terminal of MOSPD3. Peptide sequence FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title