AADAT, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-106-859	50 μL

Catalog No. 89-106-859 Supplier Abnova Corporation Supplier No. H00051166A01

Description

Mouse polyclonal antibody raised against a partial recombinant AADAT.

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. [provided by RefSeq

Sequence: YSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Specifications

• Antigen: AADAT
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant AADAT.
• Formulation: 50% glycerol
• Gene: AADAT
• Gene Accession No.: NM_016228
• Gene Alias: KAT2/KATII
• Gene Symbols: AADAT
• Host Species: Mouse
• Immunogen: AADAT (NP_057312, 326 a.a. to 425 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51166
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only