AATK, Mouse, Clone: 5B8, Abnova™

Catalog No.	Quantity
89-106-123	200 μL

Catalog No. 89-106-123 Supplier Abnova Corporation Supplier No. H00009625M03A

Description

Mouse monoclonal antibody raised against a partial recombinant AATK.

The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. [provided by RefSeq

Sequence: SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG

Specifications

• Antigen: AATK
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AATK.
• Formulation: ascites with no preservative
• Gene: AATK
• Gene Accession No.: BC047378
• Gene Alias: AATYK/AATYK1/KIAA0641/LMR1/LMTK1/p35BP
• Gene Symbols: AATK
• Host Species: Mouse
• Immunogen: AATK (AAH47378,161 a.a. ∽ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9625
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ