ABCC1, Mouse, Clone: IU5C1, Abnova™

Catalog No.	Quantity
89-110-971	100 μL

Catalog No. 89-110-971 Supplier Abnova Corporation Supplier No. MAB2374

Description

Mouse monoclonal antibody raised against synthetic peptide of ABCC1.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms. [provided by RefSeq

Sequence: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF

Specifications

• Antigen: ABCC1
• Applications: Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: IU5C1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against synthetic peptide of ABCC1.
• Dilution: Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In buffer containing 0.09% sodium azide
• Gene: ABCC1
• Gene Alias: ABC29/ABCC/DKFZp686N04233/DKFZp781G125/GS-X/MRP/MRP1
• Gene Symbols: ABCC1
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to amino acids 1-33 of human ABCC1.
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4363
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG1