ABCC2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-300	50 μL

Catalog No. 89-104-300 Supplier Abnova Corporation Supplier No. H00001244A01

Description

Mouse polyclonal antibody raised against a partial recombinant ABCC2.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq

Sequence: LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA

Specifications

• Antigen: ABCC2
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABCC2.
• Formulation: 50% glycerol
• Gene: ABCC2
• Gene Accession No.: NM_000392
• Gene Alias: ABC30/CMOAT/DJS/KIAA1010/MRP2/cMRP
• Gene Symbols: ABCC2
• Host Species: Mouse
• Immunogen: ABCC2 (NP_000383, 214 a.a. to 313 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1244
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only