ABCC6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-104-099	50 μL

Catalog No. 89-104-099 Supplier Abnova Corporation Supplier No. H00000368A01

Description

Mouse polyclonal antibody raised against a partial recombinant ABCC6.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq

Sequence: IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV

Specifications

• Antigen: ABCC6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABCC6.
• Formulation: 50% glycerol
• Gene: ABCC6
• Gene Accession No.: NM_001171
• Gene Alias: ABC34/ARA/EST349056/MLP1/MOATE/MRP6/PXE/PXE1
• Gene Symbols: ABCC6
• Host Species: Mouse
• Immunogen: ABCC6 (NP_001162, 831 a.a. to 930 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 368
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Antisera

For Research Use Only